PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1332.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family CO-like
Protein Properties Length: 342aa    MW: 37099.3 Da    PI: 6.5024
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1332.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.51.3e-08436436
                      zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                                  + C+ +++  ++lfC+ ++ +lC +C ++ H  
  evm.model.supercontig_1332.1  4 KLCDSCKSATATLFCRADSAFLCVNCDSKVHAA 36
                                  58***************************9954 PP

2zf-B_box27.75.5e-094691342
                      zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                                   ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  evm.model.supercontig_1332.1 46 VWVCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplarrHERVPV 91
                                  689*****************************66899999*99986 PP

3CCT69.39.6e-24278321144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  evm.model.supercontig_1332.1 278 REARVLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 321
                                   9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.865148IPR000315B-box-type zinc finger
SMARTSM003369.2E-15148IPR000315B-box-type zinc finger
PfamPF006431.3E-6443IPR000315B-box-type zinc finger
CDDcd000212.54E-10548No hitNo description
PROSITE profilePS5011910.8934491IPR000315B-box-type zinc finger
PfamPF006432.4E-74691IPR000315B-box-type zinc finger
CDDcd000211.48E-94791No hitNo description
SMARTSM003361.3E-104991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.658278320IPR010402CCT domain
PfamPF062031.5E-17278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MASKLCDSCK SATATLFCRA DSAFLCVNCD SKVHAANKLA SRHARVWVCE VCEQAPAHVT  60
CKADAAALCV TCDRDIHSAN PLARRHERVP VTPFYDSVAS APGAVKPNAA ATAVNFLDDR  120
YFSDVDGDAD VSREEAEAAS WLLPNPNSKA VAASPDLNTG QFMFSDMDPY LDLDYGPVDP  180
KLEAQEQNSS GTDGVVPVQS RSVQAPLVNE HCFDLDFGAS KYFPYGYNGH SLSHSVSSSS  240
VDVGVVPDGG SMADITNPYS RGAESGNQTA AQLSSADREA RVLRYREKRK NRKFEKTIRY  300
ASRKAYAEMR PRIKGRFAKR TDIEVDADRN SIYGFGIVPT F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011648.10.0CONSTANS-like 4
SwissprotQ940T91e-163COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A061GJE10.0A0A061GJE1_THECC; CONSTANS-like 4
STRINGPOPTR_0006s28350.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-158CONSTANS-like 4